Total Downloads Ranking
Most downloads over all time
170661-170680 of all 182,419 gems.
| Rank | Downloads | Name | Summary |
|---|---|---|---|
| 170,648 | 2,029 | jarebear_copyright_view_tool | Provides generated HTML data for Rails applications |
| 170,648 | 2,029 | sanna_view_tool | Provides generated HTML data for Rails applications. |
| 170,648 | 2,029 | shatter-rails | Shatter is a generator for Rails that seperates an existing model logic into separate f... |
| 170,664 | 2,028 | threddedDANIEL | The best Rails 4.2+ forums engine ever. Its goal is to be as simple and feature rich as... |
| 170,664 | 2,028 | myfirstpackagemyfirstpackagemyfirstpackage | Simple calculator API hosted on APIMATIC |
| 170,664 | 2,028 | aubi | Ruby Generic Template Builder |
| 170,664 | 2,028 | iseqc | Compile ruby to YARV instruction sequence, link iseq from multiple files into a binary ... |
| 170,664 | 2,028 | logstash-codec-avro_header | This gem is a Logstash plugin required to be installed on top of the Logstash core pipe... |
| 170,664 | 2,028 | aws_detect_sentiment | Provided Client-object to detect the sentiment of provided word/words by Aws::Comprehen... |
| 170,664 | 2,028 | omniauth-fiken | OmniAuth strategy for Fiken using OAuth2 |
| 170,664 | 2,028 | lokap-trackable | Tracks activities/events on ActiveRecord models |
| 170,664 | 2,028 | probs | Representing probabilities with objects |
| 170,664 | 2,028 | stephany_cryptodemo | [Ruby on Rails Training] Cryptodemo will allow us to perform safe transactions keeping ... |
| 170,664 | 2,028 | ransack_active_record_enhancer | Enhance active record methods with ransack. |
| 170,664 | 2,028 | google-cloud-redis-cluster-v1 | Creates and manages Redis instances on the Google Cloud Platform. Note that google-clou... |
| 170,664 | 2,028 | RPSBlahBlahBlah123 | Play rock paper scissors any time you want! |
| 170,664 | 2,028 | mgznv_view_tool | Provides generated html data for rails applications. |
| 170,664 | 2,028 | unified_csrf_prevention | Unified stateless cross-application CSRF prevention implementation for Rails |
| 170,664 | 2,028 | mruby_app | A CLI tool for using Ruby (mruby) code as a project. |
| 170,664 | 2,028 | scopedog | Democratize ActiveRecord's scopes |
xmisao